The domain within your query sequence starts at position 14 and ends at position 150; the E-value for the IFN-gamma domain shown below is 8.2e-57.

LMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISF
YLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNE
LIRVVHQLLPESSLRKR

IFN-gamma

 IFN-gamma
PFAM accession number:PF00714
Interpro abstract (IPR002069):

Interferon gamma (IFN-gamma) is produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of microphages and had antiproliferative effects on transformed cells. It can potentiate the antiviral and antitumor effects of the type I interferons.

The crystal structures of a number IFN-gamma proteins have been solved, including bovine interferon-gamma at 2.0-A [ (PUBMED:10666622) ] and human IFN-gamma at 2.9-A [ (PUBMED:10860730) ].

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:interferon-gamma receptor binding (GO:0005133)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFN-gamma