The domain within your query sequence starts at position 30 and ends at position 105; the E-value for the IFP_35_N domain shown below is 3.7e-41.

LVHEIMSENKELDEEIKKLEAELQSDAREFQIKENVPEKKLKLTSVESPKDGCHFSNSSC
SFQVSSQILYELQEGQ

IFP_35_N

IFP_35_N
PFAM accession number:PF07334
Interpro abstract (IPR009938):

This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [(PUBMED:10950963)]. This group of proteins also includes N-myc-interactor (Nmi), a homologous interferon-induced protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFP_35_N