The domain within your query sequence starts at position 1 and ends at position 119; the E-value for the IFRD domain shown below is 8.6e-44.

MSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGLKNAL
SSKVLYEFVLERRMTLTDSIERCLKKGKSDEQRAAAAVASVLCIQLGPGFESEEILKTL

IFRD

IFRD
PFAM accession number:PF05004
Interpro abstract (IPR007701): Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [(PUBMED:9050919)]. The exact function of IFRD1 is unknown but it has been shown that PC4 is necessary for muscle differentiation and that it might have a role in signal transduction. This entry also contains IFRD2 and its murine equivalent SKMc15, which are highly expressed soon after gastrulation and in the hepatic primordium, suggesting an involvement in early hematopoiesis [(PUBMED:9722946)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFRD