The domain within your query sequence starts at position 9 and ends at position 128; the E-value for the IFT20 domain shown below is 1.2e-52.

AGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENE
KMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQLERYRVEYEALCKVEAEQNEFIDQF

IFT20

IFT20
PFAM accession number:PF14931
Interpro abstract (IPR028172):

Intraflagellar transport (IFT) particle, which consists of complex A and B, is involved in assembling and maintaining eukaryotic cilia and flagella. Intraflagellar transport protein 20 (IFT20) is a subunit of the intraflagellar transport complex B (consists of IFT172, 88, 81, 80, 74/72, 57/55, 52, 46, 27, 20) [(PUBMED:12821668), (PUBMED:15337773)]. IFT20 is associated with the Golgi complex and may play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium [(PUBMED:16775004), (PUBMED:19112494)]. Besides its function in cilia, IFT20 also regulates immune synapse assembly in T cells [(PUBMED:19855387)]. In an yeast two hybrid experiment, IFT20 exhibited a strong interaction with IFT57/Hippi and the kinesin II subunit, KIF3B [(PUBMED:12821668)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFT20