The domain within your query sequence starts at position 53 and ends at position 180; the E-value for the IFT43 domain shown below is 4.5e-52.
PKPPRRQGGWADDSMKMANHRLRQQNLMGSDDDDIPVIPDLEDVQEEDFVLQVASPPSIQ VNRVMTYRDLDNDLMKYSAFQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLYTEVSS ELLTEWDL
IFT43 |
---|
PFAM accession number: | PF15305 |
---|---|
Interpro abstract (IPR029302): | Intraflagellar transport protein 43 (IFT43) is a subunit of the IFT complex A (IFT-A), which is involved in retrograde ciliary transport along microtubules from the ciliary tip to the base [ (PUBMED:21378380) ]. |
GO component: | intraciliary transport particle A (GO:0030991) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFT43