SMART: Pfam domain IFT57

The domain within your query sequence starts at position 48 and ends at position 273; the E-value for the IFT57 domain shown below is 6.4e-84.

EQIESQRVTSYPHPTTSCTQEEETDNEENFIDLNVLKAQTYRLDTNESAKQEDILESTTD
AAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDKLHNEISR
TLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERTRLLSEVTEELEK
VKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIGVVEHTL

IFT57

PFAM accession number:	PF10498
Interpro abstract (IPR019530):	Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms. Intra-flagellar transport (IFT) is required for the assembly and maintenance of eukaryotic cilia and flagella, and consists of the bi-directional movement of large protein particles between the base and the distal tip of the organelle. IFT particles contain multiple copies of two distinct protein complexes, A and B, which contain at least 6 and 11 protein subunits. IFT57 is part of complex B but is not, however, required for the core subunits to stay associated [ (PUBMED:15955805) ]. This protein is known as Huntington-interacting protein-1 in humans.

PFAM accession number:

PF10498

Interpro abstract (IPR019530):

Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms. Intra-flagellar transport (IFT) is required for the assembly and maintenance of eukaryotic cilia and flagella, and consists of the bi-directional movement of large protein particles between the base and the distal tip of the organelle. IFT particles contain multiple copies of two distinct protein complexes, A and B, which contain at least 6 and 11 protein subunits. IFT57 is part of complex B but is not, however, required for the core subunits to stay associated [ (PUBMED:15955805) ]. This protein is known as Huntington-interacting protein-1 in humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFT57