The domain within your query sequence starts at position 28 and ends at position 114; the E-value for the IGFL domain shown below is 2.5e-40.
STFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYS PKKKFIVKLKVHGERSHCSSSPISRNC
IGFL |
---|
PFAM accession number: | PF14653 |
---|---|
Interpro abstract (IPR032744): | This family includes the insulin growth factor-like proteins. These proteins are potential ligands for the IGFLR1 cell membrane receptor [ (PUBMED:21454693) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IGFL