The domain within your query sequence starts at position 5 and ends at position 152; the E-value for the IHABP4_N domain shown below is 7.4e-42.

LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSN
AAGKQLRKESQKDRKNPLPPSVGVADKKEETQPPVALKKEGIRRVGRRPDQQLQGDGKLI
DRRAERRPPRERRFEKPLEEKGEGGEFS

IHABP4_N

IHABP4_N
PFAM accession number:PF16174
Interpro abstract (IPR032381):

This is the N-terminal region of intracellular hyaluronan-binding protein 4 and SERPINE1 mRNA-binding protein 1-like proteins. This region carries nuclear localisation sites, and may also be involved in the binding to some of the partners in the translational machinery [(PUBMED:11001948), (PUBMED:12505151), (PUBMED:21771594)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IHABP4_N