The domain within your query sequence starts at position 35 and ends at position 409; the E-value for the IIGP domain shown below is 5.5e-182.

SQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGN
EEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFII
ISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCV
NTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKK
RQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDW
EIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYF
LDMVTEDAKTLLKEI

IIGP

IIGP
PFAM accession number:PF05049
Interpro abstract (IPR007743):

This entry represents a group of immunity-related GTPases like proteins, including interferon-inducible GTPase from mammals. This entry also includes some uncharacterised proteins from bacteria, fungi and invertebrates.

Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing [(PUBMED:11907101)].

GO component:membrane (GO:0016020)
GO function:GTP binding (GO:0005525)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IIGP