The domain within your query sequence starts at position 35 and ends at position 154; the E-value for the IL10 domain shown below is 1.9e-8.

ITANLQAIQKEFSEIRDSVSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSF
LIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML

IL10

IL10
PFAM accession number:PF00726
Interpro abstract (IPR020443):

Interleukin-10 (IL-10) is a protein that inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells. Structurally, IL-10 is a protein of about 160 amino acids that contains four conserved cysteines involved in disulphide bonds [ (PUBMED:8590020) ]. IL-10 is highly similar to the Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) BCRF1 protein which inhibits the synthesis of gamma-interferon and to Equid herpesvirus 2 (Equine herpesvirus 2) protein E7. It is also similar, but to a lesser degree, with human protein mda-7 [ (PUBMED:8545104) ], a protein which has antiproliferative properties in human melanoma cells. Mda-7 only contains two of the four cysteines of IL-10.

This entry represents the interleukin-10, interleukin-19, interleukin-20, interleukin-22, interleukin-24 and interleukin-26 family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL10