SMART: Pfam domain IL12p40

The domain within your query sequence starts at position 122 and ends at position 215; the E-value for the IL12p40_C domain shown below is 2.4e-31.

NKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQ
RDYEKYSVSCQEDVTCPTAEETLPIELALEARQQ

IL12p40_C

PFAM accession number:	PF10420
Interpro abstract (IPR019482):	This entry represents the central domain (domain 2) of the beta subunit (also known as subunit p40) interleukin-12 (IL-12). This domain is largely beta-stranded with a fibronectin III-like structure. IL-12 is produced on stimulation by macrophage-engulfed micro-organisms and other stimuli, when it dimerises with IL-12 subunit alpha (subunit p35) to form a heterodimer which then binds to receptors on natural killer cells to activate them to destroy the micro-organisms [ (PUBMED:10899108) ]. This domain contains two disulphide bridges, one of which serves to bind the beta subunit to the alpha subunit, and the other to hold the beta strands within the domain together. The cupped shape of the alpha subunit binding interface matches the elbow-like bend between domains 2 and 3 in the beta subunit [ (PUBMED:15661020) ]. Domain 3 also has a fibronectin iii-like structure.

PFAM accession number:

PF10420

Interpro abstract (IPR019482):

This entry represents the central domain (domain 2) of the beta subunit (also known as subunit p40) interleukin-12 (IL-12). This domain is largely beta-stranded with a fibronectin III-like structure. IL-12 is produced on stimulation by macrophage-engulfed micro-organisms and other stimuli, when it dimerises with IL-12 subunit alpha (subunit p35) to form a heterodimer which then binds to receptors on natural killer cells to activate them to destroy the micro-organisms [ (PUBMED:10899108) ]. This domain contains two disulphide bridges, one of which serves to bind the beta subunit to the alpha subunit, and the other to hold the beta strands within the domain together. The cupped shape of the alpha subunit binding interface matches the elbow-like bend between domains 2 and 3 in the beta subunit [ (PUBMED:15661020) ]. Domain 3 also has a fibronectin iii-like structure.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL12p40_C