The domain within your query sequence starts at position 1 and ends at position 207; the E-value for the IL17_R_N domain shown below is 8.2e-109.
MCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWQSIRFTDYSQHNQMVMALTLRCPLKLEA SLCWRQDPLTPCETLPNATAQESEGWYILENVDLHPQLCFKFSFENSSHVECPHQSGSLP SWTVSMDTQAQQLTLHFSSRTYATFSAAWSDPGLGPDTPMPPVYSISQTQGSVPVTLDLI IPFLRQENCILVWRSDVHFAWKHVLCP
IL17_R_N |
---|
PFAM accession number: | PF15037 |
---|---|
Interpro abstract (IPR027841): | This domain is found at the N terminus (extracellular region) of interleukin-17 receptor C and interleukin-17 receptor E. This is the presumed ligand-binding domain [ (PUBMED:11706037) ]. Human putative interleukin-17 receptor E-like consists only of this domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL17_R_N