The domain within your query sequence starts at position 189 and ends at position 432; the E-value for the IL17_R_N domain shown below is 1.3e-93.

DGDNVLLTLDVSEEQDFSFLLYLRPVPDALKSLWYKNLTGPQNITLNHTDLVPCLCIQVW
SLEPDSERVEFCPFREDPGAHRNLWHIARLRVLSPGVWQLDAPCCLPGKVTLCWQAPDQS
PCQPLVPPVPQKNATVNEPQDFQLVAGHPNLCVQVSTWEKVQLQACLWADSLGPFKDDML
LVEMKTGLNNTSVCALEPSGCTPLPSMASTRAARLGEELLQDFRSHQCMQLWNDDNMGSL
WACP

IL17_R_N

IL17_R_N
PFAM accession number:PF15037
Interpro abstract (IPR027841):

This domain is found at the N terminus (extracellular region) of interleukin-17 receptor C and interleukin-17 receptor E. This is the presumed ligand-binding domain [(PUBMED:11706037)]. Human putative interleukin-17 receptor E-like consists only of this domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL17_R_N