The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the IL1_propep domain shown below is 2.2e-38.

MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETS
KMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEETI

IL1_propep

• PFAM accession number: PF02394
• Interpro abstract (IPR003502):

  Interleukin-1 alpha and interleukin-1 beta (IL-1 alpha and IL-1 beta) are cytokines that participate in the regulation of immune responses, inflammatory reactions, and hematopoiesis [ (PUBMED:2969618) ]. Two types of IL-1 receptor, each with three extracellular immunoglobulin (Ig)-like domains, limited sequence similarity (28%) and different pharmacological characteristics have been cloned from mouse and human cell lines: these have been termed type I and type II receptors [ (PUBMED:8702856) ]. The receptors both exist in transmembrane (TM) and soluble forms: the soluble IL-1 receptor is thought to be post-translationally derived from cleavage of the extracellular portion of the membrane receptors.

  Both IL-1 receptors appear to be well conserved in evolution, and map to the same chromosomal location [ (PUBMED:1833184) ]. The receptors can both bind all three forms of IL-1 (IL-1 alpha, IL-1 beta and IL-1RA).

  The crystal structures of IL1A and IL1B [ (PUBMED:2602367) ] have been solved, showing them to share the same 12-stranded beta-sheet structure as both the heparin binding growth factors and the Kunitz-type soybean trypsin inhibitors [ (PUBMED:1738162) ]. The beta-sheets are arranged in 3 similar lobes around a central axis, 6 strands forming an anti-parallel beta-barrel. Several regions, especially the loop between strands 4 and 5, have been implicated in receptor binding.

  The Vaccinia virus genes B15R and B18R each encode proteins with N-terminal hydrophobic sequences, possible sites for attachment of N-linked carbohydrate and a short C-terminal hydrophobic domain [ (PUBMED:1826022) ]. These properties are consistent with the mature proteins being either virion, cell surface or secretory glycoproteins. Protein sequence comparisons reveal that the gene products are related to each other (20% identity) and to the Ig superfamily. The highest degree of similarity is to the human and murine interleukin-1 receptors, although both proteins are related to a wide range of Ig superfamily members, including the interleukin-6 receptor. A novel method for virus immune evasion has been proposed in which the product of one or both of these proteins may bind interleukin-1 and/or interleukin-6, preventing these cytokines reaching their natural receptors [ (PUBMED:1826022) ]. A similar gene product from Cowpox virus (CPV) has also been shown to specifically bind murine IL-1 beta [ (PUBMED:1339315) ].

  The N-terminal of Interleukin-1 is approximately 115 amino acids long, it forms a propeptide that is cleaved off to release the active interleukin-1. This signature is for the propeptide.

• GO process: inflammatory response (GO:0006954), immune response (GO:0006955)
• GO function: interleukin-1 receptor binding (GO:0005149)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL1_propep