The domain within your query sequence starts at position 32 and ends at position 189; the E-value for the IL28A domain shown below is 1.9e-76.
AKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKA LQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRW LHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANG
IL28A |
---|
PFAM accession number: | PF15177 |
---|---|
Interpro abstract (IPR029177): | Interferon (IFN)-lambda proteins belong to the new type III IFN group. In contrast to type I or type II IFNs, the response to type III IFN is cell-type specific. Only epithelial-like cells and some immune cells respond to IFN-lambda [ (PUBMED:22190970) ]. In human,four distinct proteins called IFN-lambda1 (interleukin-29, IL-29), IFN-lambda2 (IL-28A), IFN_lambda3 (IL-28B) and IFNL4 have been identified [ (PUBMED:20712453) (PUBMED:12469119) (PUBMED:23291588) ]. IFN-lambda proteins activate IFN-stimulated gene factor 3 (ISGF3), and are capable of inducing antiviral protection and MHC class I antigen expression [ (PUBMED:22190970) ]. |
GO process: | defense response to virus (GO:0051607), receptor signaling pathway via JAK-STAT (GO:0007259), positive regulation of immune response (GO:0050778) |
GO function: | cytokine activity (GO:0005125) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL28A