The domain within your query sequence starts at position 5 and ends at position 264; the E-value for the IL33 domain shown below is 4.6e-146.
MKYSNSKISPAKFSSTAGEALVPPCKIRRSQQKTKEFCHVYCMRLRSGLTIRKETSYFRK EPTKRYSLKSGTKHEENFSAYPRDSRKRSLLGSIQAFAASVDTLSIQGTSLLTQSPASLS TYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMS PIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDN QLALVEEKDESCNNIMFKLS
IL33 |
---|
PFAM accession number: | PF15095 |
---|---|
Interpro abstract (IPR026145): | This entry represents interleukin-33 (IL33), which that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8 [ (PUBMED:17185418) (PUBMED:22215666) ]. It also serves as a warning signal between cells at times of injury or cell death [ (PUBMED:22215666) ]. |
GO function: | cytokine activity (GO:0005125) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL33