The domain within your query sequence starts at position 28 and ends at position 184; the E-value for the IL34 domain shown below is 2e-79.

TLTQDKECDLTGYLRGKLQYKNRLQYMKHYFPINYRIAVPYEGVLRVANITRLQKAHVSE
RELRYLWVLVSLNATESVMDVLLEGHPSWKYLQEVQTLLENVQRSLMDVEIGPHVEAVLS
LLSTPGLSLKLVRPKALLDNCFRVMELLYCSCCKQSP

IL34

IL34
PFAM accession number:PF15036
Interpro abstract (IPR020415):

Interleukins (IL) are a group of cytokines that play an important role in the immune system. They modulate inflammation and immunity by regulating growth, mobility and differentiation of lymphoid and other cells.

This entry represents interleukin-34 (IL-34), it was identified via functional screening of a library of secreted proteins [(PUBMED:18467591)]. This cytokine promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R) [(PUBMED:18467591)].

GO process:positive regulation of protein phosphorylation (GO:0001934), positive regulation of cell proliferation (GO:0008284)
GO component:extracellular space (GO:0005615)
GO function:macrophage colony-stimulating factor receptor binding (GO:0005157)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL34