The domain within your query sequence starts at position 28 and ends at position 122; the E-value for the IL4Ra_N domain shown below is 9.9e-39.
VLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVC HMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNV
IL4Ra_N |
![]() |
---|
PFAM accession number: | PF09238 |
---|---|
Interpro abstract (IPR015319): | Interleukin-4 receptor is a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE antibody production in B cells. Among T cells, the encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitis, asthma, or eczema. The binding of IL-4 or IL-13 to the IL-4 receptor on the surface of macrophages results in the alternative activation of those macrophages. Alternatively activated macrophages downregulate inflammatory mediators such as during immune responses, particularly with regards to helminth infections. This entry represents the N-terminal (extracellular) portion of interleukin-4 receptor alpha, it is related in overall topology to fibronectin type III modules and folds into a sandwich comprising seven antiparallel beta sheets arranged in a three-strand and a four-strand beta-pleated sheet. They are required for binding of interleukin-4 to the receptor alpha chain, which is a crucial event for the generation of a Th2-dominated early immune response [ (PUBMED:10219247) ]. Members of this family are related in overall topology to fibronectin type III modules and fold into a sandwich comprising seven antiparallel beta sheets arranged in a three-strand and a four-strand beta-pleated sheet. They are required for binding of interleukin-4 to the receptor alpha chain, which is a crucial event for the generation of a Th2-dominated early immune response [ (PUBMED:10219247) ]. |
GO process: | production of molecular mediator involved in inflammatory response (GO:0002532) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | cytokine receptor activity (GO:0004896) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL4Ra_N