The domain within your query sequence starts at position 15 and ends at position 141; the E-value for the IL7 domain shown below is 1.6e-46.

SVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLL
QLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQK
TEMQRQK

IL7

 IL7
PFAM accession number:PF01415
Interpro abstract (IPR001181):

This entry represents interleukin-7 (IL7), it is a hematopoietic growth factor produced by bone marrow stromal cells. It promotes growth of B- and T-cell precursors and functions with IL2 in the activation of mature T-cells [ (PUBMED:2643102) (PUBMED:3259677) ]. IL-7 and IL-7Ralpha bind the gamma-c receptor forming a complex required for the development and homeostasis of T and B cells [ (PUBMED:19141282) ]. Interleukin-7 and Interleukin-9 belong to the same larger family.

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:interleukin-7 receptor binding (GO:0005139), growth factor activity (GO:0008083)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL7