The domain within your query sequence starts at position 1243 and ends at position 1333; the E-value for the ILEI domain shown below is 9e-14.

AGALLLIVDACSVPFRVKEKRMFLSADVSHMEEYFKASIPPRSIVLLSTRGEIKQLNISD
SLAVLGLAKPAHLYSKGSVVFLGFSGNFAPS

ILEI

ILEI
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ILEI