The domain within your query sequence starts at position 187 and ends at position 281; the E-value for the ILEI domain shown below is 2.1e-28.

RGVIVHVIDAKLGTVVHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDD
TARKAMTKLGSKHFLHLGFRHPWSFITVKGNPSSS

ILEI

ILEI
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ILEI