The domain within your query sequence starts at position 105 and ends at position 324; the E-value for the IMS domain shown below is 1.7e-47.

VDMDAFYAAVEMRDNPELKDKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQLI
IVPPNFDKYRAVSKEVKEILAEYDPNFMAMSLDEAYLNITQHLQERQDWPEDKRRYFIKM
GNYLKIDTPRQEANELTEYERSISPLLFEDSPPDLQPQGSPFQLNSEEQNNPQIAQNSVV
FGTSAEEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSD

IMS

IMS
PFAM accession number:PF00817
Interpro abstract (IPR001126):

In Escherichia coli, UV and many chemicals appear to cause mutagenesis by a process of translesion synthesis that requires DNA polymerase III and the SOS-regulated proteins UmuD, UmuC and RecA. This machinery allows the replication to continue through DNA lesion, and therefore avoid lethal interruption of DNA replication after DNA damage [(PUBMED:9560379)]. UmuC is a well conserved protein in prokaryotes, with a homologue in yeast species.

Proteins known to contain an UmuC domain are listed below:

  • E. coli MucB protein. Plasmid-born analogue of the UmuC protein.
  • Saccharomyces cerevisiae (Baker's yeast) Rev1 protein. Homologue of UmuC also required for normal induction of mutations by physical and chemical agents.
  • Salmonella typhimurium ImpB protein. Plasmid-born analogue of the UmuC protein.
  • Bacterial UmuC protein.
  • E. coli DNA-damage-inducible protein P (DinP).
  • S. typhimurium SamB homologue of UmuC plasmid associated.

GO process:DNA repair (GO:0006281)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IMS