The domain within your query sequence starts at position 1 and ends at position 114; the E-value for the IMUP domain shown below is 1.8e-39.
MEFDLAAALGPGSKKPEGAGHVGDPKHCPLKAPGGPEAGAAHKPRRVSGSSSDSSSSSSS SDSEAEGKEYAAGCKKHERSSDKAKKPKVKKEKMEKKEKKEKKEKEKKEKKAPH
IMUP |
 |
|---|
| PFAM accession number: | PF15761 |
|---|---|
| Interpro abstract (IPR026621): | Immortalization up-regulated protein is upregulated in SV40-immortalized human fibroblasts. It is localised in nucleus [ (PUBMED:11080599) ]. |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IMUP