The domain within your query sequence starts at position 24 and ends at position 1132; the E-value for the INTS2 domain shown below is < 1e-12.

VVRLASLSDPELRLLLPCLVRMALCAPADQSQSWAQDKKLILRLLSGVEAVNSIVALLSV
DFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSPRRLRLVLSELLAIM
NKVSECNGEFFFKSSELFESAVYLEEAADVLCILQAELPSLLPIVDVAEALLRVRNGAWF
LCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALRFLCRMNPSQALKVRGMVVE
ECHLPGLGVALTLDHTKTEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTFIRNGQQRKRE
TSGSVLWQMRRQLLLELMGILPTVRSTRIVEEADVEMEPTVSVYSGLKEEHVVKASALLR
LYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQEQ
LMVLWLSWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIK
PSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHK
VSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNLFQE
VIGGDSVRLTQRFSITAQLLVLYYILSYEEALLANTKTLASMQRKPKSYSSSLMDQIPIK
FLIRQAQGLQQELGGLHSALLRLLATNYPHLCIVDDWICEEEITGTDALLRRMLLTSNAK
THSPKQLQEAFSAVPVSHTQVMQIMEHLTLLSASELIPYAEVLTSNMNQLLNSGVPRRIL
QTVNKLWMVLNTVMPRRLWVMTVNALQPSIKFIRQQKYTQNDLMIDPLIVLRCDRRVHRC
PPLMDVTLHMLNGYLLASKAYLSAHLKETAEQDRPSPNNTVGLVGQTDAPEVTREELKNA
LLAAQDSAAVQILLEICLPTEEEKAKGANSDISLRNTQGVTTISTPSKETEEGEDNLLCN
LREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP
ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQAKRYSFFMPTLPSLVS
FCRAFPPLYEDIMSLLIQIGQVCASDVAT

INTS2

INTS2
PFAM accession number:PF14750
Interpro abstract (IPR029321):

This family of proteins are subunits of the integrator complex involved in snRNA transcription and processing [(PUBMED:16239144)].

GO component:integrator complex (GO:0032039)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry INTS2