The domain within your query sequence starts at position 289 and ends at position 998; the E-value for the INTS5_C domain shown below is 2.2e-249.

KIASVVGILGHLASRHGDSIRRELLRMFHDSLAGGSGGRNGEPSLQATVPFLLQLAVMSP
ALLGTVSGELVDCLKPPAVLSQLQQHLQGFPREELDNMLNLAVHLVSQASGTGAYRLLQF
LVDTAMPASVITTQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGSPGEGVLGPPPPPR
PVPFLDALRNHVGELCGETLRLERKRFLWQHQLLGLLSVYTRPSCGPEALGHLLSRARSP
EELSLATQLYAGLVVSLSGLLPLAFRSCLARVHAGTLQPPFTARFLRNLALLVGWEQQGG
EGPSALGARFGESASAHLADLAPLLLHPEEEVAEAAASLLAICPFPSEALSPSQLLGLVR
AGVHHFFSSLRLHGPPGVASASQLLTRLSQTSPAGLKAVLQLLVEGALHRGNTELFGGEM
DGDNETLSIVSTPLASASLLDINRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKIVQSRNH
QEVIYNTQSLVSLLVHCCSASGNSEREGCWGAPTLSPEAAKAVAVTLVESVCPDAAGAEL
AWPPEDHARATVERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLRGLLAALLSHW
EASRHPDTTHSPWHLEASCILVAVMAEGSLLPPALGNMHEVFSQLAPFEVRLLLLSVWGF
LREHGPLPQKFIFQSERGRFIRDFAREGGAEGGPHLSVLHSVLHRNIDRL

INTS5_C

INTS5_C
PFAM accession number:PF14838
Interpro abstract (IPR029444):

This entry represents the C-terminal of the integrator complex subunit 5 (INTS5). The integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing [(PUBMED:16239144)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry INTS5_C