The domain within your query sequence starts at position 29 and ends at position 252; the E-value for the INTS5_N domain shown below is 1e-82.

QELSQEIKAFLTGVDPILGHQLSAREHARCGLLLLRSLPPARAAVLDHLRGVFDESVRAH
LAALEESPVAGPPHLRPPPPSHVPTGGPGLEDVVHEVQQVLCEFIRANPKAWAPVISAWS
IDLMGQLSSTYSGQHQRVPHATGSLNELLQLWMGCRATRTLMDIYVQCLSALIGSCPDAC
VDALLDTSVQHSPHFDWVVAHIGSSFPGTIISRVLSCGLKDFCV

INTS5_N

INTS5_N
PFAM accession number:PF14837
Interpro abstract (IPR029445):

This entry represents the N-terminal of the integrator complex subunit 5 (INTS5). The integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing [(PUBMED:16239144)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry INTS5_N