The domain within your query sequence starts at position 110 and ends at position 194; the E-value for the IPK domain shown below is 8.2e-33.

YLKLEDVTHKFNKPCIMDVKIGRKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHL
HSDSYETQNQHYGRGLTKETLKEGE

IPK

IPK
PFAM accession number:PF03770
Interpro abstract (IPR005522):

Inositol phosphates (IPs) act as signaling messengers to regulate various cellular processes such as growth. This entry includes a group of inositol polyphosphate kinase, including inositol polyphosphate multikinase Arg82 and Inositol hexakisphosphate/inositol heptakisphosphate kinase Kcs1 from budding yeasts. They play important roles in vacuole biogenesis and the cell's response to certain environmental stresses. The kinase activity of Arg82 and Kcs1 is required for the production of soluble inositol phosphates [(PUBMED:12828642)]. Independently of its catalytic activity, Arg82 is crucial for assembling the Arg80-Mcm1 protein complex at the promoter region of genes involved in arginine metabolism [(PUBMED:12828642)].

This entry also includes human inositol hexakisphosphate kinase 1/2/3 (IP6K1/2/3)[(PUBMED:11502751)], inositol polyphosphate multikinase (IPMK) [(PUBMED:12223481)] and inositol-trisphosphate 3-kinase A/B/C (IP3KA/B/C) [(PUBMED:18498254)]. They are involved in inositol phosphate biosynthesis [(PUBMED:23050966)]. Independently of its catalytic activity, IPMK mediates the activation of mammalian target of rapamycin (mTOR) in response to essential amino acids [(PUBMED:23050966)].

GO process:inositol phosphate biosynthetic process (GO:0032958)
GO function:kinase activity (GO:0016301)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IPK