The domain within your query sequence starts at position 1 and ends at position 77; the E-value for the IPP-2 domain shown below is 1.7e-26.
MNILATYHPADKDYGFMKADEPRTPYHRLQDTDEDPSAESSLKVTPQSVAERFATMDNFL PKVLQYGDNKNSKDTDN
IPP-2 |
---|
PFAM accession number: | PF04979 |
---|---|
Interpro abstract (IPR007062): | Protein phosphatase inhibitor 2 (IPP-2) is a phosphoprotein conserved among all eukaryotes, and it appears in both the nucleus and cytoplasm of tissue culture cells [ (PUBMED:12235284) ]. Protein phosphatase inhibitor 2 family member C (PPP1R2C) has been shown to inhibit the catalytic subunit of PP1 [ (PUBMED:11076525) ]. |
GO process: | regulation of signal transduction (GO:0009966), regulation of phosphoprotein phosphatase activity (GO:0043666) |
GO function: | protein phosphatase inhibitor activity (GO:0004864) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IPP-2