The domain within your query sequence starts at position 153 and ends at position 270; the E-value for the IPP-2 domain shown below is 6.2e-31.

QRWDEMNILATYHPADKDYGFMKADEPRTPYHRLQDTDEDPSAESSLKVTPQSVAERFAT
MDNFLPKVLQYGDNKNSKDTDNFAKTYSSDFDKHRKIHYSEGKFLKSPKNLPTEEESI

IPP-2

IPP-2
PFAM accession number:PF04979
Interpro abstract (IPR007062): Protein phosphatase inhibitor 2 (IPP-2) is a phosphoprotein conserved among all eukaryotes, and it appears in both the nucleus and cytoplasm of tissue culture cells [(PUBMED:12235284)]. Protein phosphatase inhibitor 2 family member C (PPP1R2C) has been shown to inhibit the catalytic subunit of PP1 [(PUBMED:11076525)].
GO process:regulation of phosphoprotein phosphatase activity (GO:0043666), regulation of signal transduction (GO:0009966)
GO function:protein phosphatase inhibitor activity (GO:0004864)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IPP-2