The domain within your query sequence starts at position 58 and ends at position 335; the E-value for the IPPT domain shown below is 1.9e-66.

QVYEGLDIITNKVSAQEQKMCQHHMISFVDPLVTSYTVVDFRNKATALIEDIFARDKIPI
VVGGTNYYIESLLWKVLITTKPQEMGTGKVVDRKVELEKEDGHELHKRLSQVDPEMAAKL
HPHDKRKVARSLQVFEETGISHSEFLHRQHAEEGGGPLGGPLRFPNPCILWLHADQAVLD
ERLDKRVDDMLAAGLLEELRGFHRRYNLKNISENSQDYQHGIFQSIGFKEFHEYLTTEGK
CTPETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLS

IPPT

IPPT
PFAM accession number:PF01715
Interpro abstract (IPR018022):

tRNA dimethylallyltransferase alternative names include delta(2)-isopentenylpyrophosphate transferase, IPP transferral and 2-methylthio-N6-isopentyladenosine tRNA modification enzyme. This enzyme catalyses the first step in the modification of an adenosine near the anticodon to 2-methylthio-N6-isopentyladenosine.

Plants have two classes of isopentenyltransferases (IPTs): ATP/ADP isopentenyltransferases (IPT1, 3, 4-8) and tRNA IPTs (IPT2 and 9) [(PUBMED:17062755)]. Both types are included in this family.

GO process:tRNA processing (GO:0008033)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IPPT