The domain within your query sequence starts at position 23 and ends at position 109; the E-value for the IPT domain shown below is 2e-6.

LPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKVSAQEQKMCQHHM
ISFVDPLVTSYTVVDFRNKATALIEDI

IPT

IPT
PFAM accession number:PF01745
Interpro abstract (IPR002648): Adenylate dimethylallyltransferase transfers dimethylallyl groups to AMP as part of the biosynthesis of cytokinin phytohormones (Meilan et al., Aust. J. Plant Physiol. 20:621-637(1993)).
GO process:biosynthetic process (GO:0009058)
GO function:dimethylallyltranstransferase activity (GO:0004161)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IPT