The domain within your query sequence starts at position 1 and ends at position 251; the E-value for the IP_trans domain shown below is 7.5e-116.

MIIKEYRIPLPMTVDEYRIAQLYMIQKKSRNETHGQGSGVEILENRPYTDGPGGSGQYTH
KVYHVGMHIPGWFRSILPKAALRVVEESWNAYPYTRTRFTCPFVEKFSIDIETFYKTDTG
ENNNVFNLSPVEKSQLITDIIDIVKDPVPPSEYKTEEDPKLFQSVKTCRGPLSENWIQEY
KKRLLPIMCAYKLCKVEFRYWGMQSKIERFIHDTGLRRVMVRAHRQAWCWQDEWYGLTME
KIRELEREVQL

IP_trans

IP_trans
PFAM accession number:PF02121
Interpro abstract (IPR001666): Phosphatidylinositol transfer protein (PITP) is a ubiquitous cytosolic protein, thought to be involved in transport of phospholipids from their site of synthesis in the endoplasmic reticulum and Golgi to other cell membranes [(PUBMED:7774006)]. More recently, PITP has been shown to be an essential component of the polyphosphoinositide synthesis machinery and is hence required for proper signalling by epidermal growth factor and f-Met-Leu-Phe, as well as for exocytosis. The role of PITP in polyphosphoinositide synthesis may also explain its involvement in intracellular vesicular traffic [(PUBMED:7774006)].
GO process:phospholipid transport (GO:0015914)
GO component:intracellular (GO:0005622)
GO function:phospholipid transporter activity (GO:0005548)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IP_trans