SMART: Pfam domain IQCJ-SCHIP1

The domain within your query sequence starts at position 4 and ends at position 109; the E-value for the IQCJ-SCHIP1 domain shown below is 1.9e-69.

EELKRLQNPLEQVDDGKYLLENHQLAMDVENNIENYPLSLQPLESKVKIIQRAWREYLQR
QDPLEKRSPSPPSVSSDKLSSSVSMNTFSDSSTPVSVSRPLAWTVL

IQCJ-SCHIP1

PFAM accession number:	PF15157
Interpro abstract (IPR029362):	IQCJ-SCHIP1 is a fusion protein bridging two adjacent genes that encode distinct proteins, IQCJ, a novel IQ motif containing protein and SCHIP1, a schwannomin interacting protein. Its unique calmodulin-binding IQ motif at the N terminus is not shared with its shorter isoform SCHIP1, suggesting a distinctive function for this protein. It is localised to cytoplasm and actin-rich regions, and in differentiated PC12 cells is seen in neurite extensions. The exact physiological function is unclear [ (PUBMED:17045569) ]. This entry represents the N-terminal domain of IQCJ-SCHIP1. This domain covers the IQ motif.

PFAM accession number:

PF15157

Interpro abstract (IPR029362):

IQCJ-SCHIP1 is a fusion protein bridging two adjacent genes that encode distinct proteins, IQCJ, a novel IQ motif containing protein and SCHIP1, a schwannomin interacting protein. Its unique calmodulin-binding IQ motif at the N terminus is not shared with its shorter isoform SCHIP1, suggesting a distinctive function for this protein. It is localised to cytoplasm and actin-rich regions, and in differentiated PC12 cells is seen in neurite extensions. The exact physiological function is unclear [ (PUBMED:17045569) ].

This entry represents the N-terminal domain of IQCJ-SCHIP1. This domain covers the IQ motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IQCJ-SCHIP1