The domain within your query sequence starts at position 5 and ends at position 48; the E-value for the IRF domain shown below is 4.8e-11.
RMRMRPWLEMQINSNQIPGLIWINKADTKQEKKSQIPRHGRQTS
IRF |
---|
PFAM accession number: | PF00605 |
---|---|
Interpro abstract (IPR001346): | Viral infections induce the expression of type I interferons (IFN-alpha and IFN-beta) genes. The induction is due to the transcriptional activation of the IFN genes. Interferon regulatory factor I (IRF-1) is one of the transcription factors responsible for that activation. IRF-1 binds to an upstream regulatory cis element, known as the interferon consensus sequence (ICS), which is found in the promoters of type I IFN and IFN-inducible MHC class I genes. Interferon regulatory factor 2 (IRF-2) is a protein that also interacts with the ICS, but that does not function as an activator; rather, it suppresses the function of IRF-1 under certain circumstances [ (PUBMED:2691585) ]. These proteins share a highly conserved N-terminal domain of about 100 amino acid residues which is involved in DNA-binding and which contain five conserved tryptophans. This domain is known as a 'tryptophan pentad repeat' or a 'tryptophan cluster' and is also present in:
The IRF tryptophan pentad repeat DNA-binding domain has an alpha/beta architecture comprising a cluster of three alpha-helices (alpha1-alpha3) flanked on one side by a mixed four-stranded beta-sheet (beta1-beta4). It forms a helix-turn-helix motif that binds to ISRE consensus sequences found in target promoters. Three of the tryptophan residues contact DNA by recognising a GAAA sequence [ (PUBMED:9422515) ]. This entry represents the IRF tryptophan pentad repeat DNA-binding domain. |
GO function: | transcription regulatory region sequence-specific DNA binding (GO:0000976) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IRF