The domain within your query sequence starts at position 716 and ends at position 909; the E-value for the ITI_HC_C domain shown below is 1.7e-60.

SGVTVNGELIGAPAPPNGHKKQRTYFRTITILINRPERSYLEITPSRVILDGGDRLVLPC
NQSVVVGSRGLEVSVSANANITVVIQGNIAFVILIHLYKNPAPFQRDHLGFYIANSRGLS
DNCHGLLGQFLNQDAKLVGAPEEYGKNLSNQPFPRAEGMPEAILKVKGRRVPVVWKQRKI
YNGQAQVDCWFDRN

ITI_HC_C

ITI_HC_C
PFAM accession number:PF06668
Interpro abstract (IPR010600):

This entry represents the C-terminal region of inter-alpha-trypsin inhibitor heavy chains. Inter-alpha-trypsin inhibitors are glycoproteins with a high inhibitory activity against trypsin, built up from different combinations of four polypeptides: bikunin and the three heavy chains that belong to this family (HC1, HC2, HC3). The heavy chains do not have any protease inhibitory properties but have the capacity to interact in vitro and in vivo with hyaluronic acid, which promotes the stability of the extra-cellular matrix. This domain is associated with the VWA domain IPR002035.

GO process:hyaluronan metabolic process (GO:0030212)
GO function:serine-type endopeptidase inhibitor activity (GO:0004867)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ITI_HC_C