The domain within your query sequence starts at position 120 and ends at position 195; the E-value for the Ig_3 domain shown below is 1.2e-6.

KPVSQLQADFVLRHGDSGPTVELSCLASSGSPPITYRLVGNGGRVLAQQRPLHGKPANFS
LPLSQTTGWFQCEAEN

Ig_3

Ig_3
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ig_3