The domain within your query sequence starts at position 1 and ends at position 119; the E-value for the Ig_J_chain domain shown below is 1.3e-72.

MCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCD
PVEVELEDQVVTATQSNICNEDDGVPETCYMYDRNKCYTTMVPLRYHGETKMVQAALTP

Ig_J_chain

Ig_J_chain
PFAM accession number:PF15097
Interpro abstract (IPR024110):

Immunoglobulin J serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to the secretory component [(PUBMED:10972899)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ig_J_chain