The domain within your query sequence starts at position 2 and ends at position 89; the E-value for the Il2rg domain shown below is 6.7e-26.
FITVMFGAGCRELVNPWCNLLNFTVHLKQKARVPPGGTIALLAEDGHLVKLEEETTQAPS MACSLIQEQVTYVLVQKGKMGPLLTMSH
Il2rg |
 |
|---|
| PFAM accession number: | PF15874 |
|---|---|
| Interpro abstract (IPR039471): | The function of this group of proteins is not known. Proteins in this entry includes CXorf65 and C22orf15 from humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Il2rg