The domain within your query sequence starts at position 46 and ends at position 171; the E-value for the Ima1_N domain shown below is 1.1e-43.

VNCWFCNHDTLVPYGNRNCWDCPHCEQYNGFQENGDYNKPIPAQYMEHLNHVVSSVPSPR
DPAQPQQWVSSQVLLCRRCSHHQTTKIKQLAAFTPREEGRYDEEIEVYRHHLEQMYKLCR
PCQAAV

Ima1_N

Ima1_N
PFAM accession number:PF09779
Interpro abstract (IPR018617):

This domain occurs at the N terminus of the Schizosaccharomyces pombe inner nuclear membrane protein, Ima1. Ima1 interacts with other inner nuclear membrane proteins [(PUBMED:21880100), (PUBMED:22156748)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ima1_N