SMART: Pfam domain InaF-motif

The domain within your query sequence starts at position 24 and ends at position 61; the E-value for the InaF-motif domain shown below is 2.6e-20.

RGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRPP

InaF-motif

PFAM accession number:	PF15018
Interpro abstract (IPR029162):	This highly conserved motif is thought to be a transmembrane helix that binds to transient receptor potential (TRP) calcium channel. It is found in proline-rich protein 24 (PRR24) and in InaF proteins. It is known that proline-rich proteins inactivate tannins found in food compounds, and it is thought that PRR24 does too. This is important since tannins often inhibit the uptake of iron [ (PUBMED:15735089) ]. InaF is a protein required for TRP calcium channel function in Drosophila [ (PUBMED:17968007) (PUBMED:10557345) ]. TRP-related channels have been suggested to mediate "store-operated" calcium entry, important for Ca2+ homeostasis in a wide variety of cell types [ (PUBMED:10557345) ].

PFAM accession number:

PF15018

Interpro abstract (IPR029162):

This highly conserved motif is thought to be a transmembrane helix that binds to transient receptor potential (TRP) calcium channel. It is found in proline-rich protein 24 (PRR24) and in InaF proteins. It is known that proline-rich proteins inactivate tannins found in food compounds, and it is thought that PRR24 does too. This is important since tannins often inhibit the uptake of iron [ (PUBMED:15735089) ]. InaF is a protein required for TRP calcium channel function in Drosophila [ (PUBMED:17968007) (PUBMED:10557345) ]. TRP-related channels have been suggested to mediate "store-operated" calcium entry, important for Ca2+ homeostasis in a wide variety of cell types [ (PUBMED:10557345) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry InaF-motif