The domain within your query sequence starts at position 314 and ends at position 371; the E-value for the Inhibitor_Mig-6 domain shown below is 6.2e-28.

RPPKVPPREPLSRSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSSKALQRQSSEGS

Inhibitor_Mig-6

Inhibitor_Mig-6
PFAM accession number:PF11555
Interpro abstract (IPR021619):

When the kinase domain of EGFR binds to segment one of Mitogen induced gene 6 (Mig-6), EGFR becomes inactive due to the conformation it adopts which is Src/CDK like. The binding of the two proteins prevents EGFR acting as a cyclin-like activator for other kinase domains [(PUBMED:18046415)].The structure of Mig-6(1) consists of alpha helices-G and -H with a polar surface and hydrophobic residues for interactions with EGFR. A critical step for the activation of EGFR is the formation of an asymmetric dimer involving the kinase domains of the protein. Since Mig-6 binds to the kinase domain it blocks this process and EGFR becomes inactive [(PUBMED:18046415)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Inhibitor_Mig-6