SMART: Pfam domain Ins134_P3

The domain within your query sequence starts at position 1 and ends at position 318; the E-value for the Ins134_P3_kin domain shown below is 2.8e-142.

MQTFLKGKRVGYWLSEKKVKKLNFQAFAELCRKRGIEVVQLNLSRPIEEQGPLDVIIHKL
TDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYM
KDDRICSPPFMELTSLCGEDTMRLLEQNGLAFPFICKTRVAHGTNSHEMAIVFNQEGLNA
IQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPES
SSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDVNAFP
GYEGVSEFFTDLLNHIAT

Ins134_P3_kin

PFAM accession number:	PF05770
Interpro abstract (IPR040464):	This entry represents the ATP-grasp domain. Proteins containing this domain include several inositol 1, 3, 4-trisphosphate 5/6-kinase proteins. Inositol 1,3,4-trisphosphate is at a branch point in inositol phosphate metabolism. It is dephosphorylated by specific phosphatases to either inositol 3,4-bisphosphate or inositol 1,3-bisphosphate. Alternatively, it is phosphorylated to inositol 1,3,4,6-tetrakisphosphate or inositol 1,3,4,5-tetrakisphosphate by inositol trisphosphate 5/6-kinase [ (PUBMED:8662638) ].

PFAM accession number:

PF05770

Interpro abstract (IPR040464):

This entry represents the ATP-grasp domain. Proteins containing this domain include several inositol 1, 3, 4-trisphosphate 5/6-kinase proteins. Inositol 1,3,4-trisphosphate is at a branch point in inositol phosphate metabolism. It is dephosphorylated by specific phosphatases to either inositol 3,4-bisphosphate or inositol 1,3-bisphosphate. Alternatively, it is phosphorylated to inositol 1,3,4,6-tetrakisphosphate or inositol 1,3,4,5-tetrakisphosphate by inositol trisphosphate 5/6-kinase [ (PUBMED:8662638) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ins134_P3_kin