The domain within your query sequence starts at position 13 and ends at position 455; the E-value for the Ins_P5_2-kin domain shown below is 1.9e-96.

ASPGMLVLLSGNGGPEAEPGPGPGQHRGKFPECCQPTEWSSASRNHRAGVLPCCCAVRNG
ALPQRCVVLRFLKFPPNKKKTSEEILQHLQNIVDFGKNVMKDFLGENYVHCGEVVQLPLE
FVKQLCLKIQCERPESRCDKDLDTFSGYAMCLPNLTRLQTFHFAEHRPILCVEIKPKCGF
IPFSNDVTHEMKHKVCRYCMHQHLKVATGKWKKISKYCPLDLYSGNKQRMHFALRSLLQE
TQNNLRIFKNGELIYGCGDARSPVADLKELAHHLKPFFFPSNGLASGPHCTKAVIRELVH
VITRVLLSSSEKARAGALRLGLQGPRVCEASPFSRSLHNQGKNTSEHSGLPKGCLLYKTL
QVQMLDQLDIEGLYPLYKRVEQYLEEFPEERKTLQIDGPYDEVFYQKLLDLSTEDDGTVA
FALTKVQQYRVAMTAKDCSIMIA

Ins_P5_2-kin

Ins_P5_2-kin
PFAM accession number:PF06090
Interpro abstract (IPR009286):

This is a family of inositol-pentakisphosphate 2-kinases (also known as inositol 1,3,4,5,6-pentakisphosphate 2-kinase, Ins(1,3,4,5,6)P5 2-kinase) and InsP5 2-kinase). This enzyme phosphorylates Ins(1,3,4,5,6)P5 to form Ins(1,2,3,4,5,6)P6 (also known as InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, nonhomologous end-joining, endocytosis and ion channel regulation [(PUBMED:10960485)].

GO function:ATP binding (GO:0005524), inositol pentakisphosphate 2-kinase activity (GO:0035299)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ins_P5_2-kin