The domain within your query sequence starts at position 1 and ends at position 100; the E-value for the Interfer-bind domain shown below is 7.5e-20.

XPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNN
VTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQ

Interfer-bind

Interfer-bind
PFAM accession number:PF09294
Interpro abstract (IPR015373):

Proteins with this domains have a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology. They include interferon receptors, tissue factor proteins and interleukin receptors.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Interfer-bind