The domain within your query sequence starts at position 466 and ends at position 660; the E-value for the Ion_trans domain shown below is 3.8e-46.
VANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGIS VLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRY DFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILF VCGNYILLNVFLAIA
Ion_trans |
---|
PFAM accession number: | PF00520 |
---|---|
Interpro abstract (IPR005821): | This domain is found in sodium, potassium, and calcium ion channels proteins. The proteins have 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some Na channel proteins the domain is repeated four times, whereas in others (e.g. K channels) the protein forms a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not included in the Pfam family due to it lacking the first four helices. |
GO process: | transmembrane transport (GO:0055085), ion transport (GO:0006811) |
GO component: | membrane (GO:0016020) |
GO function: | ion channel activity (GO:0005216) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans