The domain within your query sequence starts at position 329 and ends at position 414; the E-value for the Ion_trans_2 domain shown below is 7.9e-16.

GLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGK
IVGSLCAIAGVLTIALPVPVIVSNFN

Ion_trans_2

Ion_trans_2
PFAM accession number:PF07885
Interpro abstract (IPR013099):

This domain is found in a variety of potassium channel proteins, including the two membrane helix type ion channels found in bacteria [(PUBMED:11836519)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans_2