The domain within your query sequence starts at position 130 and ends at position 235; the E-value for the Ipi1_N domain shown below is 9.7e-24.

RTEHISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEHYPALITGRSSILLKNFVEL
ISHQQLSKGLVNRDRSQSWILSVNPNRRVTSQQWRLKVLARLSKFL

Ipi1_N

Ipi1_N
PFAM accession number:PF12333
Interpro abstract (IPR024679):

This entry represents a domain found in the N terminus of the pre-rRNA-processing protein Ipi1. This domain can also be found in testis-expressed sequence 10 protein (TEX10).

In Saccharomyces cerevisiae, Ipi1 is a component of the RIX1 complex required for processing of ITS2 sequences from 35S pre-rRNA [ (PUBMED:15528184) (PUBMED:14759368) ].

In humans, TEX10 is a component of some MLL1/MLL complex, a protein complex that can methylate lysine-4 of histone H3 [ (PUBMED:15960975) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ipi1_N