The domain within your query sequence starts at position 16 and ends at position 163; the E-value for the Isochorismatase domain shown below is 1.6e-28.
SILFLCDLQEKFRPSIAYFPQIVSVAARMLKVARLLDVPILLTEQYPEGLGPTVPELGAQ GIRPVSKTCFSMVPALQKELDGRSQLQSVLLCGIETQACILNTALDLLHRGLQVHVVVDA CSSRSQVDRLVALARMRQSGAFLATSES
Isochorismatase |
---|
PFAM accession number: | PF00857 |
---|---|
Interpro abstract (IPR000868): | This is a family of hydrolase enzymes. Isochorismatase, also known as 2,3 dihydro-2,3 dihydroxybenzoate synthase catalyses the conversion of isochorismate, in the presence of water, to 2,3-dihydroxybenzoate and pyruvate ( EC 3.3.2.1 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Isochorismatase