The domain within your query sequence starts at position 16 and ends at position 163; the E-value for the Isochorismatase domain shown below is 2.3e-26.

SILFLCDMQEKLRDRILYFPQIVSKAARMLKVAQMLEIPVLLTEHYPQGLGPTVPELGAQ
GLRTMSKTSFSMVPPLQQELDKLPQLQSVLLCGIETQGCILHTALDLLDRGLQVHVAVDA
CSSQSEMNRLVALARMQQSGVFLSTSEV

Isochorismatase

Isochorismatase
PFAM accession number:PF00857
Interpro abstract (IPR000868):

This is a family of hydrolase enzymes. Isochorismatase, also known as 2,3 dihydro-2,3 dihydroxybenzoate synthase catalyses the conversion of isochorismate, in the presence of water, to 2,3-dihydroxybenzoate and pyruvate (EC 3.3.2.1).

GO process:metabolic process (GO:0008152)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Isochorismatase