The domain within your query sequence starts at position 1 and ends at position 50; the E-value for the Isy1 domain shown below is 8.1e-17.

MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQLA

Isy1

Isy1
PFAM accession number:PF06246
Interpro abstract (IPR009360):

This entry includes yeast Isy1 and it's homologues from plants and animals. In budding yeast, Isy1 is part of the NineTeen Complex (NTC), which is involved in spliceosome activation by specifying the interaction of U5 and U6 with pre-mRNA for their stable association with the spliceosome after U4 dissociation [ (PUBMED:16540691) ]. The S. pombe homologue is known as Cwf12.

GO process:generation of catalytic spliceosome for second transesterification step (GO:0000350)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Isy1